SCOPe 2.06: Domain d5b3ka_: 5b3k A:

Lineage for d5b3ka_ (5b3k A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (24 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [330632] (2 PDB entries)

8. Domain d5b3ka_: 5b3k A: [330635]
   automated match to d2m6sa_
   complexed with so4; mutant

Details for d5b3ka_

PDB Entry: 5b3k, 1.7 Å

PDB Description: c101a mutant of flavodoxin from pseudomonas aeruginosa

PDB Compounds: (A:) Uncharacterized protein PA3435

SCOPe Domain Sequences for d5b3ka_:

Sequence; same for both SEQRES and ATOM records:

>d5b3ka_ c.23.5.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mkvailsgsvygtaeevarhaqkllsaagleashlprasldelkafapeaflvvtsttgm
gelpdnlqplyyairdqlpawhglpggviglgdssygdtfagggeqvrelfgelgvrevl
pmlrldasetvtpetdaepwlaefaaalkg

Timeline for d5b3ka_:

• d5b3ka_ is new in SCOPe 2.06-stable
  
• d5b3ka_ appears in SCOPe 2.07
  
• d5b3ka_ appears in the current release, SCOPe 2.08