Lineage for d5b3ka_ (5b3k A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2115525Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2116045Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2116046Protein automated matches [190158] (24 species)
    not a true protein
  7. 2116160Species Pseudomonas aeruginosa [TaxId:208964] [330632] (2 PDB entries)
  8. 2116161Domain d5b3ka_: 5b3k A: [330635]
    automated match to d2m6sa_
    complexed with so4; mutant

Details for d5b3ka_

PDB Entry: 5b3k (more details), 1.7 Å

PDB Description: c101a mutant of flavodoxin from pseudomonas aeruginosa
PDB Compounds: (A:) Uncharacterized protein PA3435

SCOPe Domain Sequences for d5b3ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b3ka_ c.23.5.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mkvailsgsvygtaeevarhaqkllsaagleashlprasldelkafapeaflvvtsttgm
gelpdnlqplyyairdqlpawhglpggviglgdssygdtfagggeqvrelfgelgvrevl
pmlrldasetvtpetdaepwlaefaaalkg

SCOPe Domain Coordinates for d5b3ka_:

Click to download the PDB-style file with coordinates for d5b3ka_.
(The format of our PDB-style files is described here.)

Timeline for d5b3ka_: