![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
![]() | Protein Tryparedoxin I [52904] (2 species) |
![]() | Species Crithidia fasciculata [TaxId:5656] [52905] (8 PDB entries) |
![]() | Domain d1ewxa_: 1ewx A: [33062] |
PDB Entry: 1ewx (more details), 1.7 Å
SCOPe Domain Sequences for d1ewxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ewxa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} sgldkylpgieklrrgdgevevkslagklvffyfsaswcppcrgftpqliefydkfhesk nfevvfctwdeeedgfagyfakmpwlavpfaqseavqklskhfnvesiptligvdadsgd vvttraratlvkdpegeqfpwkda
Timeline for d1ewxa_: