Lineage for d1ewxa_ (1ewx A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24524Family c.47.1.10: Glutathione peroxidase-like [52901] (5 proteins)
  6. 24554Protein Tryparedoxin I [52904] (1 species)
  7. 24555Species Crithidia fasciculata [TaxId:5656] [52905] (3 PDB entries)
  8. 24557Domain d1ewxa_: 1ewx A: [33062]

Details for d1ewxa_

PDB Entry: 1ewx (more details), 1.7 Å

PDB Description: Crystal structure of native tryparedoxin I from Crithidia fasciculata

SCOP Domain Sequences for d1ewxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewxa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata}
sgldkylpgieklrrgdgevevkslagklvffyfsaswcppcrgftpqliefydkfhesk
nfevvfctwdeeedgfagyfakmpwlavpfaqseavqklskhfnvesiptligvdadsgd
vvttraratlvkdpegeqfpwkda

SCOP Domain Coordinates for d1ewxa_:

Click to download the PDB-style file with coordinates for d1ewxa_.
(The format of our PDB-style files is described here.)

Timeline for d1ewxa_: