Lineage for d1qk8a_ (1qk8 A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (10 families) 
Family c.47.1.10: Glutathione peroxidase-like [52901] (5 proteins) Protein Tryparedoxin I [52904] (1 species) Species Crithidia fasciculata [TaxId:5656] [52905] (3 PDB entries) 
Domain d1qk8a_: 1qk8 A: [33061]
Details for d1qk8a_
PDB Entry: 1qk8 (more details), 1.4 Å
PDB Description: tryparedoxin-i from crithidia fasciculata
SCOP Domain Sequences for d1qk8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qk8a_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata}
gldkylpgieklrrgdgevevkslagklvffyfsaswcppcrgftpqliefydkfheskn
fevvfctwdeeedgfagyfakmpwlavpfaqseavqklskhfnvesiptligvdadsgdv
vttraratlvkdpegeqfpwkda
SCOP Domain Coordinates for d1qk8a_:
Click to download the PDB-style file with coordinates for d1qk8a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qk8a_:
- d1qk8a_ appears in SCOP 1.57
- d1qk8a_ appears in the current release, SCOPe 2.08
View in 3D