Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) The phosphate moiety of substrate binds in the 'common' phosphate-binding site |
Family c.1.5.0: automated matches [227276] (1 protein) not a true family |
Protein automated matches [227084] (16 species) not a true protein |
Species Clostridium perfringens [TaxId:195103] [258287] (8 PDB entries) |
Domain d5uwxc1: 5uwx C:1-482 [330605] Other proteins in same PDB: d5uwxa2, d5uwxc2 automated match to d4q33a_ complexed with 8l7, acy, imp, mpd, mrd |
PDB Entry: 5uwx (more details), 1.85 Å
SCOPe Domain Sequences for d5uwxc1:
Sequence, based on SEQRES records: (download)
>d5uwxc1 c.1.5.0 (C:1-482) automated matches {Clostridium perfringens [TaxId: 195103]} marilktaytfddvllvpnksevlpnevslktqltkkiqlniplmsasmdtvteskmaia mareggigiihknmtiedqarevdrvkrsggllcgasigvtndmmervdavvkakvdviv ldtahghskgviegvkrikakypelqviagniatpeavrdlaeagadcvkvgigpgsict trivagvgvpqltavmdcaeegkklgipviadgglkysgdivkalaagacaammgsifag ceeapgaieiyqgrsykvyrgmgslgamakgssdryfqngtkkfvpegvegriaykghla dtiyqliggiksgmgylgaptlenlyenanfvvqtsagfreshphdinitkeapnysv
>d5uwxc1 c.1.5.0 (C:1-482) automated matches {Clostridium perfringens [TaxId: 195103]} marilktaytfddvllvpnksevlpnevslktqltkkiqlniplmsasmdtvteskmaia mareggigiihknmtiedqarevdrvkrsggllcgasigvtndmmervdavvkakvdviv ldtahghskgviegvkrikakypelqviagniatpeavrdlaeagadcvkvgigpgsict trivagvgvpqltavmdcaeegkklgipviadgglkysgdivkalaagacaammgsifag ceeapgaieiyqgrsykvyrgmgslgamavpegvegriaykghladtiyqliggiksgmg ylgaptlenlyenanfvvqtsagfreshphdinitkeapnysv
Timeline for d5uwxc1:
View in 3D Domains from other chains: (mouse over for more information) d5uwxa1, d5uwxa2, d5uwxb_, d5uwxd_ |