![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, alpha-chain [46486] (24 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46487] (253 PDB entries) Uniprot P69905 P01922 P01934 P01935 |
![]() | Domain d5ucua_: 5ucu A: [330581] Other proteins in same PDB: d5ucub_ automated match to d1bz1a_ complexed with h2s, hem |
PDB Entry: 5ucu (more details), 1.8 Å
SCOPe Domain Sequences for d5ucua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ucua_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]} vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa vhasldkflasvstvltsky
Timeline for d5ucua_: