SCOP 1.75: Domain d1eejb1: 1eej B:61-216

Lineage for d1eejb1 (1eej B:61-216)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (23 families)

5. Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (2 proteins)
   elaborated common fold

6. Protein Disulfide bond isomerase, DsbC, C-terminal domain [52899] (2 species)

7. Species Escherichia coli [TaxId:562] [52900] (5 PDB entries)
   Uniprot P21892

8. Domain d1eejb1: 1eej B:61-216 [33058]
   Other proteins in same PDB: d1eeja2, d1eejb2
   complexed with mes

Details for d1eejb1

PDB Entry: 1eej, 1.9 Å

PDB Description: crystal structure of the protein disulfide bond isomerase, dsbc, from escherichia coli

PDB Compounds: (B:) thiol:disulfide interchange protein

SCOP Domain Sequences for d1eejb1:

Sequence; same for both SEQRES and ATOM records:

>d1eejb1 c.47.1.9 (B:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]}
nvtnkmllkqlnalekemivykapqekhvitvftditcgychklheqmadynalgitvry
lafprqgldsdaekemkaiwcakdknkafddvmagksvapascdvdiadhyalgvqlgvs
gtpavvlsngtlvpgyqppkemkefldehqkmtsgk

Timeline for d1eejb1:

• d1eejb1 first appeared (with stable ids) in SCOP 1.55
  
• d1eejb1 appears in SCOP 1.73
  
• d1eejb1 appears in SCOPe 2.01
  
• d1eejb1 appears in the current release, SCOPe 2.08