Lineage for d1eejb1 (1eej B:61-216)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70801Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 70802Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 71221Family c.47.1.9: Disulfide bond isomerase, DsbC, C-terminal domain [52898] (1 protein)
  6. 71222Protein Disulfide bond isomerase, DsbC, C-terminal domain [52899] (1 species)
  7. 71223Species Escherichia coli [TaxId:562] [52900] (1 PDB entry)
  8. 71225Domain d1eejb1: 1eej B:61-216 [33058]
    Other proteins in same PDB: d1eeja2, d1eejb2

Details for d1eejb1

PDB Entry: 1eej (more details), 1.9 Å

PDB Description: crystal structure of the protein disulfide bond isomerase, dsbc, from escherichia coli

SCOP Domain Sequences for d1eejb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eejb1 c.47.1.9 (B:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli}
nvtnkmllkqlnalekemivykapqekhvitvftditcgychklheqmadynalgitvry
lafprqgldsdaekemkaiwcakdknkafddvmagksvapascdvdiadhyalgvqlgvs
gtpavvlsngtlvpgyqppkemkefldehqkmtsgk

SCOP Domain Coordinates for d1eejb1:

Click to download the PDB-style file with coordinates for d1eejb1.
(The format of our PDB-style files is described here.)

Timeline for d1eejb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eejb2