Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (3 proteins) elaborated common fold |
Protein Disulfide bond isomerase, DsbC, C-terminal domain [52899] (2 species) |
Species Escherichia coli [TaxId:562] [52900] (5 PDB entries) Uniprot P21892 |
Domain d1eeja1: 1eej A:61-216 [33057] Other proteins in same PDB: d1eeja2, d1eejb2 complexed with mes |
PDB Entry: 1eej (more details), 1.9 Å
SCOPe Domain Sequences for d1eeja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} nvtnkmllkqlnalekemivykapqekhvitvftditcgychklheqmadynalgitvry lafprqgldsdaekemkaiwcakdknkafddvmagksvapascdvdiadhyalgvqlgvs gtpavvlsngtlvpgyqppkemkefldehqkmtsgk
Timeline for d1eeja1: