Lineage for d1qgva_ (1qgv A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1369326Family c.47.1.8: spliceosomal protein U5-15Kd [52895] (2 proteins)
    automatically mapped to Pfam PF02966
  6. 1369327Protein spliceosomal protein U5-15Kd [52896] (1 species)
  7. 1369328Species Human (Homo sapiens) [TaxId:9606] [52897] (3 PDB entries)
  8. 1369329Domain d1qgva_: 1qgv A: [33056]

Details for d1qgva_

PDB Entry: 1qgv (more details), 1.4 Å

PDB Description: human spliceosomal protein u5-15kd
PDB Compounds: (A:) spliceosomal protein u5-15kd

SCOPe Domain Sequences for d1qgva_:

Sequence, based on SEQRES records: (download)

>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]}
symlphlhngwqvdqailseedrvvvirfghdwdptcmkmdevlysiaekvknfaviylv
ditevpdfnkmyelydpctvmfffrnkhimidlgtgnnnkinwamedkqemvdiietvyr
garkgrglvvspkdyst

Sequence, based on observed residues (ATOM records): (download)

>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]}
symlphlhngwqvdqailseedrvvvirfghdwdptcmkmdevlysiaekvknfaviylv
ditevpdfnkmyelydpctvmfffrnkhimidlginwamedkqemvdiietvyrgarkgr
glvvspkdyst

SCOPe Domain Coordinates for d1qgva_:

Click to download the PDB-style file with coordinates for d1qgva_.
(The format of our PDB-style files is described here.)

Timeline for d1qgva_: