![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.7: ERP29 N domain-like [52892] (3 proteins) automatically mapped to Pfam PF07912 |
![]() | Protein Endoplasmic reticulum protein ERP29, N-terminal domain [52893] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [52894] (1 PDB entry) |
![]() | Domain d1g7ea_: 1g7e A: [33055] |
PDB Entry: 1g7e (more details)
SCOPe Domain Sequences for d1g7ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} lhtkgalpldtvtfykvipkskfvlvkfdtqypygekqdefkrlaensassddllvaevg isdygdklnmelsekykldkesypvfylfrdgdfenpvpysgavkvgaiqrwlkgqgvyl gm
Timeline for d1g7ea_: