Lineage for d1g7ea_ (1g7e A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877366Family c.47.1.7: ERP29 N domain-like [52892] (3 proteins)
    automatically mapped to Pfam PF07912
  6. 2877367Protein Endoplasmic reticulum protein ERP29, N-terminal domain [52893] (1 species)
  7. 2877368Species Norway rat (Rattus norvegicus) [TaxId:10116] [52894] (1 PDB entry)
  8. 2877369Domain d1g7ea_: 1g7e A: [33055]

Details for d1g7ea_

PDB Entry: 1g7e (more details)

PDB Description: nmr structure of n-domain of erp29 protein
PDB Compounds: (A:) endoplasmic reticulum protein erp29

SCOPe Domain Sequences for d1g7ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lhtkgalpldtvtfykvipkskfvlvkfdtqypygekqdefkrlaensassddllvaevg
isdygdklnmelsekykldkesypvfylfrdgdfenpvpysgavkvgaiqrwlkgqgvyl
gm

SCOPe Domain Coordinates for d1g7ea_:

Click to download the PDB-style file with coordinates for d1g7ea_.
(The format of our PDB-style files is described here.)

Timeline for d1g7ea_: