![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.6: Phosducin [52888] (1 protein) automatically mapped to Pfam PF02114 |
![]() | Protein Phosducin [52889] (2 species) the transducin beta subunit-binding subdomain is an irregular array of helices in the N-terminal extension |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [52890] (3 PDB entries) |
![]() | Domain d1b9xc_: 1b9x C: [33053] Other proteins in same PDB: d1b9xa_, d1b9xb_ complexed with gd |
PDB Entry: 1b9x (more details), 3 Å
SCOPe Domain Sequences for d1b9xc_:
Sequence, based on SEQRES records: (download)
>d1b9xc_ c.47.1.6 (C:) Phosducin {Norway rat (Rattus norvegicus) [TaxId: 10116]} egqathtgpkgvindwrkfklesedgdsippskkeilrqmsspqsrddkdskermsrkme iqeyelihqdkedegclrkyrrqcmqdmhqklsfgprygfvyeletgeqfletiekeqkv ttivvniyedgvrgcdalnssleclaaeypmvkfckirasntgagdrfssdvlptllvyk ggelisnfisvaeqfaedffaadvesflneygllper
>d1b9xc_ c.47.1.6 (C:) Phosducin {Norway rat (Rattus norvegicus) [TaxId: 10116]} egqathtgpkgvindwrkfklesedegclrkyrrqcmqdmhqklsfgprygfvyeletge qfletiekeqkvttivvniyedgvrgcdalnssleclaaeypmvkfckirasntgagdrf ssdvlptllvykggelisnfisvaeqfaedffaadvesflneygllper
Timeline for d1b9xc_: