![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (12 families) ![]() |
![]() | Family c.47.1.6: Phosducin [52888] (1 protein) |
![]() | Protein Phosducin [52889] (2 species) the transducin beta subunit-binding subdomain is an irregular array of helices in the N-terminal extension |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [52890] (3 PDB entries) |
![]() | Domain d1b9yc_: 1b9y C: [33052] Other proteins in same PDB: d1b9ya_, d1b9yb_ complexed with gd |
PDB Entry: 1b9y (more details), 3 Å
SCOP Domain Sequences for d1b9yc_:
Sequence, based on SEQRES records: (download)
>d1b9yc_ c.47.1.6 (C:) Phosducin {Rat (Rattus norvegicus)} egqathtgpkgvindwrkfklesedgdsippskkeilrqmsspqsrddkdskermsrkms iqeyelihqdkedegclrkyrrqcmqdmhqklsfgprygfvyeletgeqfletiekeqkv ttivvniyedgvrgcdalnssleclaaeypmvkfckirasntgagdrfssdvlptllvyk ggelisnfisvaeqfaedffaadvesflneygllper
>d1b9yc_ c.47.1.6 (C:) Phosducin {Rat (Rattus norvegicus)} egqathtgpkgvindwrkfklesegclrkyrrqcmqdmhqklsfgprygfvyeletgeqf letiekeqkvttivvniyedgvrgcdalnssleclaaeypmvkfckirasntgagdrfss dvlptllvykggelisnfisvaeqfaedffaadvesflneygllper
Timeline for d1b9yc_: