Lineage for d2trcp_ (2trc P:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 244778Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 244779Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 245261Family c.47.1.6: Phosducin [52888] (1 protein)
  6. 245262Protein Phosducin [52889] (2 species)
    the transducin beta subunit-binding subdomain is an irregular array of helices in the N-terminal extension
  7. 245265Species Rat (Rattus norvegicus) [TaxId:10116] [52890] (3 PDB entries)
  8. 245266Domain d2trcp_: 2trc P: [33051]
    Other proteins in same PDB: d2trcb_, d2trcg_
    complexed with gd

Details for d2trcp_

PDB Entry: 2trc (more details), 2.4 Å

PDB Description: phosducin/transducin beta-gamma complex

SCOP Domain Sequences for d2trcp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus)}
egqathtgpkgvindwrkfklesedgdsippskkeilrqmsspqsrddkdskermsrkms
iqeyelihqdkedegclrkyrrqcmqdmhqklsfgprygfvyeletgeqfletiekeqkv
ttivvniyedgvrgcdalnssleclaaeypmvkfckirasntgagdrfssdvlptllvyk
ggelisnfisvaeqfaedffaadvesflneygllper

SCOP Domain Coordinates for d2trcp_:

Click to download the PDB-style file with coordinates for d2trcp_.
(The format of our PDB-style files is described here.)

Timeline for d2trcp_: