Lineage for d2trcp_ (2trc P:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24503Family c.47.1.6: Phosducin [52888] (1 protein)
  6. 24504Protein Phosducin [52889] (2 species)
  7. 24507Species Rat (Rattus norvegicus) [TaxId:10116] [52890] (3 PDB entries)
  8. 24508Domain d2trcp_: 2trc P: [33051]
    Other proteins in same PDB: d2trcb_, d2trcg_

Details for d2trcp_

PDB Entry: 2trc (more details), 2.4 Å

PDB Description: phosducin/transducin beta-gamma complex

SCOP Domain Sequences for d2trcp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus)}
egqathtgpkgvindwrkfklesedgdsippskkeilrqmsspqsrddkdskermsrkms
iqeyelihqdkedegclrkyrrqcmqdmhqklsfgprygfvyeletgeqfletiekeqkv
ttivvniyedgvrgcdalnssleclaaeypmvkfckirasntgagdrfssdvlptllvyk
ggelisnfisvaeqfaedffaadvesflneygllper

SCOP Domain Coordinates for d2trcp_:

Click to download the PDB-style file with coordinates for d2trcp_.
(The format of our PDB-style files is described here.)

Timeline for d2trcp_: