| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Yeast prion protein ure2p, nitrogen regulation fragment [52886] (1 species) similar to class phi enzymes |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52887] (8 PDB entries) |
| Domain d1g6yb2: 1g6y B:98-200 [33050] Other proteins in same PDB: d1g6ya1, d1g6yb1 |
PDB Entry: 1g6y (more details), 2.8 Å
SCOPe Domain Sequences for d1g6yb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g6yb2 c.47.1.5 (B:98-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eysritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrapefv
svnpnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpl
Timeline for d1g6yb2: