SCOPe 2.05: Domain d1g6ya2: 1g6y A:109-200

Lineage for d1g6ya2 (1g6y A:109-200)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Yeast prion protein ure2p, nitrogen regulation fragment [52886] (1 species)
   similar to class phi enzymes

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52887] (8 PDB entries)

8. Domain d1g6ya2: 1g6y A:109-200 [33049]
   Other proteins in same PDB: d1g6ya1, d1g6yb1

Details for d1g6ya2

PDB Entry: 1g6y, 2.8 Å

PDB Description: crystal structure of the globular region of the prion protein ure2 from yeast saccharomyces cerevisiae

PDB Compounds: (A:) ure2 protein

SCOPe Domain Sequences for d1g6ya2:

Sequence; same for both SEQRES and ATOM records:

>d1g6ya2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrapefvsvnpnarvpal
idhgmdnlsiwesgaillhlvnkyyketgnpl

Timeline for d1g6ya2:

• d1g6ya2 first appeared (with stable ids) in SCOP 1.55
  
• d1g6ya2 appears in SCOPe 2.04
  
• d1g6ya2 appears in SCOPe 2.06
  
• d1g6ya2 appears in the current release, SCOPe 2.08