Lineage for d5ksha1 (5ksh A:238-573)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3014879Species Neisseria gonorrhoeae [TaxId:485] [225541] (16 PDB entries)
  8. 3014907Domain d5ksha1: 5ksh A:238-573 [330470]
    Other proteins in same PDB: d5ksha2, d5kshb2
    automated match to d3eqva2
    complexed with gol, so4; mutant

Details for d5ksha1

PDB Entry: 5ksh (more details), 2.4 Å

PDB Description: crystal structure of penicillin-binding protein 2 from neisseria gonorrhoeae containing an a501t mutation associated with cephalosporin resistance
PDB Compounds: (A:) Penicillin-binding protein 2

SCOPe Domain Sequences for d5ksha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ksha1 e.3.1.0 (A:238-573) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
sldqriqtlayeelnkaveyhqakagtvvvldartgeilalantpaydpnrpgradseqr
rnravtdmiepgsaikpfviakaldagktdlnerlntqpykigpspvrdthvypsldvrg
imqkssnvgtsklsarfgaeemydfyhelgigvrmhsgfpgetagllrnwrrwrpieqat
msfgyglqlsllqlaraytalthdgvllplsfekqavapqgkrifkestarevrnlmvsv
tepggtgtagavdgfdvgaktgttrklvngryvdnkhvgtfigfapaknprvivavtide
ptahgyyggvvagspfkkimggslnilgisptkplt

SCOPe Domain Coordinates for d5ksha1:

Click to download the PDB-style file with coordinates for d5ksha1.
(The format of our PDB-style files is described here.)

Timeline for d5ksha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ksha2