![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.1: AAT-like [53384] (17 proteins) |
![]() | Protein Aspartate aminotransferase, AAT [53385] (9 species) |
![]() | Species Pig (Sus scrofa), cytosolic form [TaxId:9823] [53388] (8 PDB entries) |
![]() | Domain d5tota1: 5tot A:0-412 [330466] Other proteins in same PDB: d5tota2, d5totb2 automated match to d3wzfa_ mutant |
PDB Entry: 5tot (more details), 1.4 Å
SCOPe Domain Sequences for d5tota1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tota1 c.67.1.1 (A:0-412) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} mappsvfaevpqaqpvlvfkliadfredpdprkvnlgvgayrtddcqpwvlpvvrkveqr iannsslnheylpilglaefrtcasrlalgddspalqekrvggvqslggtgalrigaefl arwyngtnnkdtpvyvssptwenlngvfttagfkdirsyrywdtekrgldlqgflsdlen apefsifvllacahnptgtdptpeqwkqiasvmkrrflfpffdsayqgfasgnlekdawa iryfvsegfelfcaqsfsknfglynervgnltvvakepdsilrvlsqmqkivrvtwsnpp aqgarivartlsdpelfhewtgnvktmadrilsmrselrarlealktpgtwnhitdqigm fsftglnpkqveylinqkhiyllpsgrinmcglttknldyvatsiheavtkiq
Timeline for d5tota1: