Lineage for d5mkra2 (5mkr A:189-380)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2137195Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2137589Protein automated matches [226905] (13 species)
    not a true protein
  7. 2137645Species Human (Homo sapiens) [TaxId:9606] [225574] (46 PDB entries)
  8. 2137702Domain d5mkra2: 5mkr A:189-380 [330455]
    Other proteins in same PDB: d5mkra3
    automated match to d1s3xa2
    complexed with flc, ti8

Details for d5mkra2

PDB Entry: 5mkr (more details), 1.87 Å

PDB Description: hsp72-nbd bound to compound tci 8 - tyr15 in up-conformation
PDB Compounds: (A:) heat shock 70 kda protein 1a

SCOPe Domain Sequences for d5mkra2:

Sequence, based on SEQRES records: (download)

>d5mkra2 c.55.1.1 (A:189-380) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnhfveefkrk
hkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitrarfeelcsd
lfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdlnksinpdea
vaygaavqaail

Sequence, based on observed residues (ATOM records): (download)

>d5mkra2 c.55.1.1 (A:189-380) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnhfveefkrkh
kkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitrarfeelcsdl
frstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdlnksinpdeav
aygaavqaail

SCOPe Domain Coordinates for d5mkra2:

Click to download the PDB-style file with coordinates for d5mkra2.
(The format of our PDB-style files is described here.)

Timeline for d5mkra2: