Lineage for d5tx6b_ (5tx6 B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033672Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 3033759Protein TGF-beta2 [57510] (2 species)
  7. 3033773Species Mouse (Mus musculus) [TaxId:10090] [330451] (2 PDB entries)
  8. 3033777Domain d5tx6b_: 5tx6 B: [330452]
    automated match to d2tgia_
    complexed with ca; mutant

    missing some secondary structures that made up less than one-third of the common domain

Details for d5tx6b_

PDB Entry: 5tx6 (more details), 2.75 Å

PDB Description: structure of tgf-beta2 derivative with deletion of residues 52-71 and 10 single amino acid mutations (mmtgf-beta2-7m)
PDB Compounds: (B:) Transforming growth factor beta-2

SCOPe Domain Sequences for d5tx6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tx6b_ g.17.1.2 (B:) TGF-beta2 {Mouse (Mus musculus) [TaxId: 10090]}
aldaaycfrnvqdncclrplyidfrkdlgwkwihepkgynanfcagacpyraskspscvs
qdlepltivyyvgrkpkveqlsnmivksckcs

SCOPe Domain Coordinates for d5tx6b_:

Click to download the PDB-style file with coordinates for d5tx6b_.
(The format of our PDB-style files is described here.)

Timeline for d5tx6b_: