Class g: Small proteins [56992] (100 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins) |
Protein TGF-beta2 [57510] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [330451] (2 PDB entries) |
Domain d5tx6b_: 5tx6 B: [330452] automated match to d2tgia_ complexed with ca; mutant missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 5tx6 (more details), 2.75 Å
SCOPe Domain Sequences for d5tx6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tx6b_ g.17.1.2 (B:) TGF-beta2 {Mouse (Mus musculus) [TaxId: 10090]} aldaaycfrnvqdncclrplyidfrkdlgwkwihepkgynanfcagacpyraskspscvs qdlepltivyyvgrkpkveqlsnmivksckcs
Timeline for d5tx6b_: