Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.0: automated matches [191488] (1 protein) not a true family |
Protein automated matches [190781] (45 species) not a true protein |
Species Kluyveromyces lactis [TaxId:284590] [330403] (1 PDB entry) |
Domain d5ifka_: 5ifk A: [330450] automated match to d3khsa_ complexed with hpa |
PDB Entry: 5ifk (more details), 1.97 Å
SCOPe Domain Sequences for d5ifka_:
Sequence, based on SEQRES records: (download)
>d5ifka_ c.56.2.0 (A:) automated matches {Kluyveromyces lactis [TaxId: 284590]} dineqraliksahryisekledhfsseflpkalvicgsglsgistkiadepkplilsyst ipgfkvstvpghsgelifgymngapvvlmngrlhsyeghslaetvhpiralhllgsinvl ivtnaagginasfkagdlmcvydhinfpglcgfhplrganfdefgprflatsdaydlelr kllfskkkelnierkihegtysyvhgptfesraesrflrlagtdavgmstvpevvtarhc gwrvlalslitnecvvdppasahdenpvpiqegkatheevlensakaskdvqelifsvva ei
>d5ifka_ c.56.2.0 (A:) automated matches {Kluyveromyces lactis [TaxId: 284590]} dineqraliksahryisekledhfsseflpkalvicgsglsgistkiadepkplilsyst ipgfkvgelifgymngapvvlmngrlhsyeghslaetvhpiralhllgsinvlivtnaag ginasfkagdlmcvydhinfpglcgfhplrganfdefgprflatsdaydlelrkllfskk kelnierkihegtysyvhgptfesraesrflrlagtdavgmstvpevvtarhcgwrvlal slitnecvvdppasahdenpvpiqegkatheevlensakaskdvqelifsvvaei
Timeline for d5ifka_: