![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins) |
![]() | Protein Beta-glucosidase A [51528] (10 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [89475] (8 PDB entries) Uniprot Q08638 |
![]() | Domain d5n6tb1: 5n6t B:2-445 [330448] Other proteins in same PDB: d5n6tb2 automated match to d1oifb_ complexed with 8p2, cl, edo |
PDB Entry: 5n6t (more details), 2.1 Å
SCOPe Domain Sequences for d5n6tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n6tb1 c.1.8.4 (B:2-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} nvkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrw kedieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyh wdlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvha pgmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrf mhqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvk fdpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvs edgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdy stqkrivkdsgywysnvvknngle
Timeline for d5n6tb1: