SCOPe 2.08: Domain d5n6tb1: 5n6t B:2-445

Lineage for d5n6tb1 (5n6t B:2-445)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins)

6. Protein Beta-glucosidase A [51528] (10 species)

7. Species Thermotoga maritima [TaxId:2336] [89475] (8 PDB entries)
   Uniprot Q08638

8. Domain d5n6tb1: 5n6t B:2-445 [330448]
   Other proteins in same PDB: d5n6tb2
   automated match to d1oifb_
   complexed with 8p2, cl, edo

Details for d5n6tb1

PDB Entry: 5n6t, 2.1 Å

PDB Description: thermotoga maritima family 1 glycoside hydrolase complexed with a cyclophellitol analogue transition state mimic

PDB Compounds: (B:) beta-glucosidase a

SCOPe Domain Sequences for d5n6tb1:

Sequence; same for both SEQRES and ATOM records:

>d5n6tb1 c.1.8.4 (B:2-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]}
nvkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrw
kedieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyh
wdlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvha
pgmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrf
mhqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvk
fdpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvs
edgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdy
stqkrivkdsgywysnvvknngle

Timeline for d5n6tb1:

• d5n6tb1 first appeared in SCOPe 2.06
  
• d5n6tb1 appears in SCOPe 2.07