Lineage for d5n6sa_ (5n6s A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2831434Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins)
  6. 2831444Protein Beta-glucosidase A [51528] (10 species)
  7. 2831493Species Thermotoga maritima [TaxId:2336] [89475] (8 PDB entries)
    Uniprot Q08638
  8. 2831506Domain d5n6sa_: 5n6s A: [330431]
    automated match to d1oifa_
    complexed with 8p5, act, cl, edo, imd, peg, pge

Details for d5n6sa_

PDB Entry: 5n6s (more details), 2.1 Å

PDB Description: thermotoga maritima family 1 glycoside hydrolase complexed with carba- cyclophellitol transition state mimic
PDB Compounds: (A:) beta-glucosidase a

SCOPe Domain Sequences for d5n6sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n6sa_ c.1.8.4 (A:) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]}
vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm
hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf
dpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse
dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys
tqkrivkdsgywysnvvknngle

SCOPe Domain Coordinates for d5n6sa_:

Click to download the PDB-style file with coordinates for d5n6sa_.
(The format of our PDB-style files is described here.)

Timeline for d5n6sa_: