Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins) |
Protein Beta-glucosidase A [51528] (10 species) |
Species Thermotoga maritima [TaxId:2336] [89475] (8 PDB entries) Uniprot Q08638 |
Domain d5n6sa_: 5n6s A: [330431] automated match to d1oifa_ complexed with 8p5, act, cl, edo, imd, peg, pge |
PDB Entry: 5n6s (more details), 2.1 Å
SCOPe Domain Sequences for d5n6sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n6sa_ c.1.8.4 (A:) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf dpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys tqkrivkdsgywysnvvknngle
Timeline for d5n6sa_: