Lineage for d5jbsd_ (5jbs D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2544190Family d.17.4.26: VirB8-like [160029] (2 proteins)
    Pfam PF04335
  6. 2544210Protein automated matches [190553] (2 species)
    not a true protein
  7. 2544213Species Brucella suis [TaxId:204722] [330344] (1 PDB entry)
  8. 2544217Domain d5jbsd_: 5jbs D: [330425]
    automated match to d2bhma1
    complexed with cl, epe, gol, peg

Details for d5jbsd_

PDB Entry: 5jbs (more details), 1.95 Å

PDB Description: conformational changes during monomer-to-dimer transition of brucella suis virb8
PDB Compounds: (D:) type IV secretion system protein virb8

SCOPe Domain Sequences for d5jbsd_:

Sequence, based on SEQRES records: (download)

>d5jbsd_ d.17.4.26 (D:) automated matches {Brucella suis [TaxId: 204722]}
sydtvrdkywlsqyviaretydwytlqkdyetvgmlsspsegqsyasqfqgdkaldkqyg
snvrtsvtivsivpngkgigtvrfakttkrtnetgdgetthwiatigyqyvnpslmsesa
rltnplgfnvtsyrvdpemg

Sequence, based on observed residues (ATOM records): (download)

>d5jbsd_ d.17.4.26 (D:) automated matches {Brucella suis [TaxId: 204722]}
sydtvrdkywlsqyviaretydwytlqkdyetvgmlsspsegqsyasqfqldkqygsnvr
tsvtivsivpngkgigtvrfakttkrtnetgdgetthwiatigyqyvnpslmsesarltn
plgfnvtsyrvdpemg

SCOPe Domain Coordinates for d5jbsd_:

Click to download the PDB-style file with coordinates for d5jbsd_.
(The format of our PDB-style files is described here.)

Timeline for d5jbsd_: