![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein automated matches [226837] (9 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries) |
![]() | Domain d5lxtb1: 5lxt B:1-245 [330408] Other proteins in same PDB: d5lxtb2, d5lxtc2, d5lxtd2, d5lxte_, d5lxtf1, d5lxtf2, d5lxtf3 automated match to d4drxb1 complexed with 7ak, acp, ca, gdp, gtp, mes, mg |
PDB Entry: 5lxt (more details), 1.9 Å
SCOPe Domain Sequences for d5lxtb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lxtb1 c.32.1.1 (B:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]} mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl rfp
Timeline for d5lxtb1: