![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein automated matches [227071] (5 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226565] (65 PDB entries) |
![]() | Domain d5lxtc2: 5lxt C:246-440 [330398] Other proteins in same PDB: d5lxtb1, d5lxtc1, d5lxtd1, d5lxte_, d5lxtf1, d5lxtf2, d5lxtf3 automated match to d4i50a2 complexed with 7ak, acp, ca, gdp, gtp, mes, mg |
PDB Entry: 5lxt (more details), 1.9 Å
SCOPe Domain Sequences for d5lxtc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lxtc2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvdsv
Timeline for d5lxtc2: