Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Class beta GST [81368] (4 species) |
Species Sphingomonas paucimobilis [TaxId:13689] [52885] (1 PDB entry) |
Domain d1f2ea2: 1f2e A:1-80 [33039] Other proteins in same PDB: d1f2ea1, d1f2eb1, d1f2ec1, d1f2ed1 complexed with gsh |
PDB Entry: 1f2e (more details), 2.3 Å
SCOPe Domain Sequences for d1f2ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} mklfispgacslaphialretgadfeavkvdlavrkteagedfltvnpsgkvpaltldsg etltenpaillyiadqnpas
Timeline for d1f2ea2: