Lineage for d5gp9a2 (5gp9 A:79-195)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2728262Family a.121.1.0: automated matches [227226] (1 protein)
    not a true family
  6. 2728263Protein automated matches [226967] (6 species)
    not a true protein
  7. 2728271Species Bacillus halodurans [TaxId:272558] [330330] (2 PDB entries)
  8. 2728272Domain d5gp9a2: 5gp9 A:79-195 [330384]
    Other proteins in same PDB: d5gp9a1, d5gp9b1
    automated match to d1vi0a2
    complexed with gol, mg, plm

Details for d5gp9a2

PDB Entry: 5gp9 (more details), 1.76 Å

PDB Description: structural analysis of fatty acid degradation regulator fadr from bacillus halodurans
PDB Compounds: (A:) Transcriptional regulator (TetR/AcrR family)

SCOPe Domain Sequences for d5gp9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gp9a2 a.121.1.0 (A:79-195) automated matches {Bacillus halodurans [TaxId: 272558]}
dveeklkilvnmhfkqlaadhklaivtqlelrqsntelrlkinevlkgylnlldellmeg
kekgyffqeldtrlarqmifgtldevvtnwvmkdckydltalvkpvhqlllgglrhr

SCOPe Domain Coordinates for d5gp9a2:

Click to download the PDB-style file with coordinates for d5gp9a2.
(The format of our PDB-style files is described here.)

Timeline for d5gp9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5gp9a1