| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
| Protein automated matches [190674] (25 species) not a true protein |
| Species Bacillus halodurans [TaxId:272558] [330328] (2 PDB entries) |
| Domain d5gp9a1: 5gp9 A:3-78 [330383] Other proteins in same PDB: d5gp9a2, d5gp9b2 automated match to d1vi0a1 complexed with gol, mg, plm |
PDB Entry: 5gp9 (more details), 1.76 Å
SCOPe Domain Sequences for d5gp9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gp9a1 a.4.1.0 (A:3-78) automated matches {Bacillus halodurans [TaxId: 272558]}
kkkgpkydqiidaavqviaehgyhqaqvskiakaagvadgtiylyfnnkedvlislfqek
mgrfvdkirsqmneat
Timeline for d5gp9a1: