SCOPe 2.08: Domain d5gp9a1: 5gp9 A:3-78

Lineage for d5gp9a1 (5gp9 A:3-78)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (25 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:272558] [330328] (2 PDB entries)

8. Domain d5gp9a1: 5gp9 A:3-78 [330383]
   Other proteins in same PDB: d5gp9a2, d5gp9b2
   automated match to d1vi0a1
   complexed with gol, mg, plm

Details for d5gp9a1

PDB Entry: 5gp9, 1.76 Å

PDB Description: structural analysis of fatty acid degradation regulator fadr from bacillus halodurans

PDB Compounds: (A:) Transcriptional regulator (TetR/AcrR family)

SCOPe Domain Sequences for d5gp9a1:

Sequence; same for both SEQRES and ATOM records:

>d5gp9a1 a.4.1.0 (A:3-78) automated matches {Bacillus halodurans [TaxId: 272558]}
kkkgpkydqiidaavqviaehgyhqaqvskiakaagvadgtiylyfnnkedvlislfqek
mgrfvdkirsqmneat

Timeline for d5gp9a1:

• d5gp9a1 first appeared in SCOPe 2.06
  
• d5gp9a1 appears in SCOPe 2.07