SCOPe 2.06: Domain d5lxtd1: 5lxt D:1-245

Lineage for d5lxtd1 (5lxt D:1-245)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (48 PDB entries)

8. Domain d5lxtd1: 5lxt D:1-245 [330373]
   Other proteins in same PDB: d5lxtb2, d5lxtc2, d5lxtd2, d5lxte_, d5lxtf1, d5lxtf2, d5lxtf3
   automated match to d4drxb1
   complexed with 7ak, acp, ca, gdp, gtp, mes, mg

Details for d5lxtd1

PDB Entry: 5lxt, 1.9 Å

PDB Description: tubulin-discodermolide complex

PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5lxtd1:

Sequence; same for both SEQRES and ATOM records:

>d5lxtd1 c.32.1.1 (D:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d5lxtd1:

• d5lxtd1 is new in SCOPe 2.06-stable
  
• d5lxtd1 appears in SCOPe 2.07
  
• d5lxtd1 appears in the current release, SCOPe 2.08