![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.3: Cytochromes [47175] (3 families) ![]() Heme-containing proteins |
![]() | Family a.24.3.0: automated matches [271165] (1 protein) not a true family |
![]() | Protein automated matches [271167] (4 species) not a true protein |
![]() | Species Hydrogenophilus thermoluteolus [TaxId:297] [330319] (1 PDB entry) |
![]() | Domain d5b3id_: 5b3i D: [330365] automated match to d3vrcb_ complexed with hec |
PDB Entry: 5b3i (more details), 1.89 Å
SCOPe Domain Sequences for d5b3id_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b3id_ a.24.3.0 (D:) automated matches {Hydrogenophilus thermoluteolus [TaxId: 297]} dalkpedkvkfrqasyttmawnmgkikamvvdgtmpfsqtqvsaaanviaaiansgmgal yspdtlgvvgfkksrlkenffqeqdevrkiatnfveqanklaevaamgdkdeikaqfgev gkackachekfreee
Timeline for d5b3id_: