Lineage for d2pmtb2 (2pmt B:1-80)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484529Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2484705Protein Class beta GST [81368] (4 species)
  7. 2484715Species Proteus mirabilis [TaxId:584] [52884] (2 PDB entries)
  8. 2484717Domain d2pmtb2: 2pmt B:1-80 [33036]
    Other proteins in same PDB: d2pmta1, d2pmtb1, d2pmtc1, d2pmtd1
    complexed with gsh

Details for d2pmtb2

PDB Entry: 2pmt (more details), 2.7 Å

PDB Description: glutathione transferase from proteus mirabilis
PDB Compounds: (B:) glutathione transferase

SCOPe Domain Sequences for d2pmtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pmtb2 c.47.1.5 (B:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]}
mklyytpgscslsphivlretgldfsieridlrtkktesgkdflainpkgqvpvlqldng
diltegvaivqyladlkpdr

SCOPe Domain Coordinates for d2pmtb2:

Click to download the PDB-style file with coordinates for d2pmtb2.
(The format of our PDB-style files is described here.)

Timeline for d2pmtb2: