| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
| Family a.121.1.0: automated matches [227226] (1 protein) not a true family |
| Protein automated matches [226967] (6 species) not a true protein |
| Species Bacillus halodurans [TaxId:272558] [330330] (2 PDB entries) |
| Domain d5gp9b2: 5gp9 B:79-194 [330357] Other proteins in same PDB: d5gp9a1, d5gp9b1 automated match to d1vi0a2 complexed with gol, mg, plm |
PDB Entry: 5gp9 (more details), 1.76 Å
SCOPe Domain Sequences for d5gp9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gp9b2 a.121.1.0 (B:79-194) automated matches {Bacillus halodurans [TaxId: 272558]}
dveeklkilvnmhfkqlaadhklaivtqlelrqsntelrlkinevlkgylnlldellmeg
kekgyffqeldtrlarqmifgtldevvtnwvmkdckydltalvkpvhqlllgglrh
Timeline for d5gp9b2: