![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
![]() | Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
![]() | Family a.121.1.0: automated matches [227226] (1 protein) not a true family |
![]() | Protein automated matches [226967] (5 species) not a true protein |
![]() | Species Bacillus halodurans [TaxId:272558] [330330] (2 PDB entries) |
![]() | Domain d5gpab2: 5gpa B:79-193 [330336] Other proteins in same PDB: d5gpaa1, d5gpab1 automated match to d1vi0a2 complexed with gol, mg |
PDB Entry: 5gpa (more details), 2.05 Å
SCOPe Domain Sequences for d5gpab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gpab2 a.121.1.0 (B:79-193) automated matches {Bacillus halodurans [TaxId: 272558]} dveeklkilvnmhfkqlaadhklaivtqlelrqsntelalkinevlkgylnlldellmeg kekgyffqeldtrlarqmifgtldevvtnwvmkdckydltalvkpvhqlllgglr
Timeline for d5gpab2: