SCOPe 2.08: Domain d5gpab2: 5gpa B:79-193

Lineage for d5gpab2 (5gpa B:79-193)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.0: automated matches [227226] (1 protein)
   not a true family

6. Protein automated matches [226967] (6 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:272558] [330330] (2 PDB entries)

8. Domain d5gpab2: 5gpa B:79-193 [330336]
   Other proteins in same PDB: d5gpaa1, d5gpab1
   automated match to d1vi0a2
   complexed with gol, mg

Details for d5gpab2

PDB Entry: 5gpa, 2.05 Å

PDB Description: structural analysis of fatty acid degradation regulator fadr from bacillus halodurans

PDB Compounds: (B:) Transcriptional regulator (TetR/AcrR family)

SCOPe Domain Sequences for d5gpab2:

Sequence; same for both SEQRES and ATOM records:

>d5gpab2 a.121.1.0 (B:79-193) automated matches {Bacillus halodurans [TaxId: 272558]}
dveeklkilvnmhfkqlaadhklaivtqlelrqsntelalkinevlkgylnlldellmeg
kekgyffqeldtrlarqmifgtldevvtnwvmkdckydltalvkpvhqlllgglr

Timeline for d5gpab2:

• d5gpab2 first appeared in SCOPe 2.06
  
• d5gpab2 appears in SCOPe 2.07