![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein automated matches [190057] (28 species) not a true protein |
![]() | Species Talaromyces verruculosus [TaxId:198730] [330334] (6 PDB entries) |
![]() | Domain d5i6sa_: 5i6s A: [330335] automated match to d1h1na_ |
PDB Entry: 5i6s (more details), 2.1 Å
SCOPe Domain Sequences for d5i6sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i6sa_ c.1.8.3 (A:) automated matches {Talaromyces verruculosus [TaxId: 198730]} assfewfgsnesgaefgsgnipgvegtdytfpnttaiqilidagmnifrvpflmermipt emtgsldtayfegysevinyitgkgahavvdphnfgryygtpisstsdfqtfwstlasqf ksndlvifdtnneyhdmdesvvvalnqaaidgirdagattqyifvegnaysgawtwttyn tamvnltdpsdlivyemhqyldsdgsgtsdqcvsstvgqervvdattwlqsngklgilge faggansvceeavegmldylaensdvwlgaswwsagpwwqdyiysmeppngiayesylsi letyf
Timeline for d5i6sa_: