SCOPe 2.06: Domain d5gpaa2: 5gpa A:79-195

Lineage for d5gpaa2 (5gpa A:79-195)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.0: automated matches [227226] (1 protein)
   not a true family

6. Protein automated matches [226967] (5 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:272558] [330330] (2 PDB entries)

8. Domain d5gpaa2: 5gpa A:79-195 [330331]
   Other proteins in same PDB: d5gpaa1, d5gpab1
   automated match to d1vi0a2
   complexed with gol, mg

Details for d5gpaa2

PDB Entry: 5gpa, 2.05 Å

PDB Description: structural analysis of fatty acid degradation regulator fadr from bacillus halodurans

PDB Compounds: (A:) Transcriptional regulator (TetR/AcrR family)

SCOPe Domain Sequences for d5gpaa2:

Sequence, based on SEQRES records:

>d5gpaa2 a.121.1.0 (A:79-195) automated matches {Bacillus halodurans [TaxId: 272558]}
dveeklkilvnmhfkqlaadhklaivtqlelrqsntelalkinevlkgylnlldellmeg
kekgyffqeldtrlarqmifgtldevvtnwvmkdckydltalvkpvhqlllgglrhr

Sequence, based on observed residues (ATOM records):

>d5gpaa2 a.121.1.0 (A:79-195) automated matches {Bacillus halodurans [TaxId: 272558]}
dveeklkilvnmhfkqlaadhklaivtqleltelalkinevlkgylnlldellmegkekg
yffqeldtrlarqmifgtldevvtnwvmkdckydltalvkpvhqlllgglrhr

Timeline for d5gpaa2:

• d5gpaa2 is new in SCOPe 2.06-stable
  
• d5gpaa2 appears in SCOPe 2.07
  
• d5gpaa2 appears in the current release, SCOPe 2.08