Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (23 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
Protein Class beta GST [81368] (3 species) |
Species Escherichia coli [TaxId:562] [52883] (3 PDB entries) |
Domain d1b8xa2: 1b8x A:1-80 [33033] Other proteins in same PDB: d1b8xa1 |
PDB Entry: 1b8x (more details), 2.7 Å
SCOP Domain Sequences for d1b8xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b8xa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg dvkltqsmaiiryiadkhnm
Timeline for d1b8xa2: