Lineage for d5b5fa_ (5b5f A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2806126Protein automated matches [190191] (2 species)
    not a true protein
  7. 2806221Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries)
  8. 2806246Domain d5b5fa_: 5b5f A: [330323]
    automated match to d4yvbb_
    complexed with 6f3

Details for d5b5fa_

PDB Entry: 5b5f (more details), 1.2 Å

PDB Description: crystal structure of alis3-streptavidin complex
PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d5b5fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b5fa_ b.61.1.1 (A:) automated matches {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp

SCOPe Domain Coordinates for d5b5fa_:

Click to download the PDB-style file with coordinates for d5b5fa_.
(The format of our PDB-style files is described here.)

Timeline for d5b5fa_: