Lineage for d5b3ia_ (5b3i A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699500Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2699891Family a.24.3.0: automated matches [271165] (1 protein)
    not a true family
  6. 2699892Protein automated matches [271167] (4 species)
    not a true protein
  7. 2699893Species Hydrogenophilus thermoluteolus [TaxId:297] [330319] (1 PDB entry)
  8. 2699894Domain d5b3ia_: 5b3i A: [330320]
    automated match to d3vrcb_
    complexed with hec

Details for d5b3ia_

PDB Entry: 5b3i (more details), 1.89 Å

PDB Description: homo-dimeric structure of cytochrome c' from thermophilic hydrogenophilus thermoluteolus
PDB Compounds: (A:) cytochrome c prime

SCOPe Domain Sequences for d5b3ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b3ia_ a.24.3.0 (A:) automated matches {Hydrogenophilus thermoluteolus [TaxId: 297]}
dalkpedkvkfrqasyttmawnmgkikamvvdgtmpfsqtqvsaaanviaaiansgmgal
yspdtlgvvgfkksrlkenffqeqdevrkiatnfveqanklaevaamgdkdeikaqfgev
gkackachekfreee

SCOPe Domain Coordinates for d5b3ia_:

Click to download the PDB-style file with coordinates for d5b3ia_.
(The format of our PDB-style files is described here.)

Timeline for d5b3ia_: