![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (3 superfamilies) |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (10 families) ![]() |
![]() | Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins) |
![]() | Protein Glutathione S-transferase [52863] (22 species) |
![]() | Species Escherichia coli [TaxId:562] [52883] (2 PDB entries) |
![]() | Domain d1a0fb2: 1a0f B:1-80 [33032] Other proteins in same PDB: d1a0fa1, d1a0fb1 |
PDB Entry: 1a0f (more details), 2.1 Å
SCOP Domain Sequences for d1a0fb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a0fb2 c.47.1.5 (B:1-80) Glutathione S-transferase {Escherichia coli} mklfykpgacslashitlresgkdftlvsvdlmkkrlengddyfavnpkgqvpalllddg tlltegvaimqyladsvpdr
Timeline for d1a0fb2: