SCOP 1.55: Domain d1a0fb2: 1a0f B:1-80

Lineage for d1a0fb2 (1a0f B:1-80)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)

6. Protein Glutathione S-transferase [52863] (22 species)

7. Species Escherichia coli [TaxId:562] [52883] (2 PDB entries)

8. Domain d1a0fb2: 1a0f B:1-80 [33032]
   Other proteins in same PDB: d1a0fa1, d1a0fb1

Details for d1a0fb2

PDB Entry: 1a0f, 2.1 Å

PDB Description: crystal structure of glutathione s-transferase from escherichia coli complexed with glutathionesulfonic acid

SCOP Domain Sequences for d1a0fb2:

Sequence; same for both SEQRES and ATOM records:

>d1a0fb2 c.47.1.5 (B:1-80) Glutathione S-transferase {Escherichia coli}
mklfykpgacslashitlresgkdftlvsvdlmkkrlengddyfavnpkgqvpalllddg
tlltegvaimqyladsvpdr

Timeline for d1a0fb2:

• d1a0fb2 appears in SCOP 1.57
  
• d1a0fb2 appears in the current release, SCOPe 2.08