Lineage for d1a0fa2 (1a0f A:1-80)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2876765Protein Class beta GST [81368] (4 species)
  7. 2876766Species Escherichia coli [TaxId:562] [52883] (3 PDB entries)
  8. 2876769Domain d1a0fa2: 1a0f A:1-80 [33031]
    Other proteins in same PDB: d1a0fa1, d1a0fb1
    complexed with gts

Details for d1a0fa2

PDB Entry: 1a0f (more details), 2.1 Å

PDB Description: crystal structure of glutathione s-transferase from escherichia coli complexed with glutathionesulfonic acid
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1a0fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0fa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]}
mklfykpgacslashitlresgkdftlvsvdlmkkrlengddyfavnpkgqvpalllddg
tlltegvaimqyladsvpdr

SCOPe Domain Coordinates for d1a0fa2:

Click to download the PDB-style file with coordinates for d1a0fa2.
(The format of our PDB-style files is described here.)

Timeline for d1a0fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a0fa1