SCOPe 2.08: Domain d1a0fa2: 1a0f A:1-80

Lineage for d1a0fa2 (1a0f A:1-80)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class beta GST [81368] (4 species)

7. Species Escherichia coli [TaxId:562] [52883] (3 PDB entries)

8. Domain d1a0fa2: 1a0f A:1-80 [33031]
   Other proteins in same PDB: d1a0fa1, d1a0fb1
   complexed with gts

Details for d1a0fa2

PDB Entry: 1a0f, 2.1 Å

PDB Description: crystal structure of glutathione s-transferase from escherichia coli complexed with glutathionesulfonic acid

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1a0fa2:

Sequence; same for both SEQRES and ATOM records:

>d1a0fa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]}
mklfykpgacslashitlresgkdftlvsvdlmkkrlengddyfavnpkgqvpalllddg
tlltegvaimqyladsvpdr

Timeline for d1a0fa2:

• d1a0fa2 first appeared (with stable ids) in SCOP 1.55
  
• d1a0fa2 appears in SCOPe 2.07