Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) automatically mapped to Pfam PF05151 |
Family f.23.35.1: PsbM-like [161034] (2 proteins) Pfam PF05151 |
Protein Photosystem II reaction center protein M, PsbM [161035] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [189918] (21 PDB entries) |
Domain d5b66m_: 5b66 m: [330307] Other proteins in same PDB: d5b66a_, d5b66b_, d5b66c_, d5b66d_, d5b66e_, d5b66f_, d5b66h_, d5b66i_, d5b66j_, d5b66k_, d5b66l_, d5b66o_, d5b66t_, d5b66u_, d5b66v_, d5b66x_, d5b66z_ automated match to d2axtm1 complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 5b66 (more details), 1.85 Å
SCOPe Domain Sequences for d5b66m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b66m_ f.23.35.1 (m:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus vulcanus [TaxId: 32053]} mevnqlgliatalfvlvpsvfliilyvqtesqqk
Timeline for d5b66m_: