Lineage for d5b66m_ (5b66 m:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631923Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) (S)
    automatically mapped to Pfam PF05151
  5. 2631924Family f.23.35.1: PsbM-like [161034] (2 proteins)
    Pfam PF05151
  6. 2631925Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)
  7. 2631938Species Thermosynechococcus vulcanus [TaxId:32053] [189918] (21 PDB entries)
  8. 2631941Domain d5b66m_: 5b66 m: [330307]
    Other proteins in same PDB: d5b66a_, d5b66b_, d5b66c_, d5b66d_, d5b66e_, d5b66f_, d5b66h_, d5b66i_, d5b66j_, d5b66k_, d5b66l_, d5b66o_, d5b66t_, d5b66u_, d5b66v_, d5b66x_, d5b66z_
    automated match to d2axtm1
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b66m_

PDB Entry: 5b66 (more details), 1.85 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (m:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d5b66m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b66m_ f.23.35.1 (m:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus vulcanus [TaxId: 32053]}
mevnqlgliatalfvlvpsvfliilyvqtesqqk

SCOPe Domain Coordinates for d5b66m_:

Click to download the PDB-style file with coordinates for d5b66m_.
(The format of our PDB-style files is described here.)

Timeline for d5b66m_: