SCOPe 2.08: Domain d5b66x_: 5b66 x:

Lineage for d5b66x_ (5b66 x:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family)
   Pfam PF06596

5. Family f.23.40.1: PsbX-like [267615] (2 proteins)

6. Protein automated matches [267680] (2 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (27 PDB entries)

8. Domain d5b66x_: 5b66 x: [330306]
   Other proteins in same PDB: d5b66a_, d5b66b_, d5b66c_, d5b66d_, d5b66e_, d5b66f_, d5b66h_, d5b66i_, d5b66j_, d5b66k_, d5b66l_, d5b66m_, d5b66o_, d5b66t_, d5b66u_, d5b66v_, d5b66z_
   automated match to d4il6x_
   complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b66x_

PDB Entry: 5b66, 1.85 Å

PDB Description: crystal structure analysis of photosystem ii complex

PDB Compounds: (x:) Photosystem II reaction center protein X

SCOPe Domain Sequences for d5b66x_:

Sequence; same for both SEQRES and ATOM records:

>d5b66x_ f.23.40.1 (x:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
titpslkgffigllsgavvlgltfavliaisqidk

Timeline for d5b66x_:

• d5b66x_ first appeared in SCOPe 2.06
  
• d5b66x_ appears in SCOPe 2.07