Lineage for d1aw9a2 (1aw9 A:2-82)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132062Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2132377Protein Class phi GST [81367] (3 species)
  7. 2132385Species Maize (Zea mays), type III [TaxId:4577] [52882] (1 PDB entry)
  8. 2132386Domain d1aw9a2: 1aw9 A:2-82 [33030]
    Other proteins in same PDB: d1aw9a1
    complexed with cd

Details for d1aw9a2

PDB Entry: 1aw9 (more details), 2.2 Å

PDB Description: structure of glutathione s-transferase iii in apo form
PDB Compounds: (A:) glutathione s-transferase III

SCOPe Domain Sequences for d1aw9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]}
aplklygmplspnvvrvatvlnekgldfeivpvdlttgahkqpdflalnpfgqipalvdg
devlfesrainryiaskyase

SCOPe Domain Coordinates for d1aw9a2:

Click to download the PDB-style file with coordinates for d1aw9a2.
(The format of our PDB-style files is described here.)

Timeline for d1aw9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aw9a1