| Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
| Fold c.47: Thioredoxin fold [52832] (3 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (10 families) ![]() |
| Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins) |
| Protein Glutathione S-transferase [52863] (24 species) |
| Species Maize (Zea mays), type III [TaxId:4577] [52882] (1 PDB entry) |
| Domain d1aw9_2: 1aw9 2-82 [33030] Other proteins in same PDB: d1aw9_1 |
PDB Entry: 1aw9 (more details), 2.2 Å
SCOP Domain Sequences for d1aw9_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aw9_2 c.47.1.5 (2-82) Glutathione S-transferase {Maize (Zea mays), type III}
aplklygmplspnvvrvatvlnekgldfeivpvdlttgahkqpdflalnpfgqipalvdg
devlfesrainryiaskyase
Timeline for d1aw9_2: