Lineage for d1aw9_2 (1aw9 2-82)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70801Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 70802Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 70930Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins)
  6. 70934Protein Glutathione S-transferase [52863] (24 species)
  7. 71093Species Maize (Zea mays), type III [TaxId:4577] [52882] (1 PDB entry)
  8. 71094Domain d1aw9_2: 1aw9 2-82 [33030]
    Other proteins in same PDB: d1aw9_1

Details for d1aw9_2

PDB Entry: 1aw9 (more details), 2.2 Å

PDB Description: structure of glutathione s-transferase iii in apo form

SCOP Domain Sequences for d1aw9_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aw9_2 c.47.1.5 (2-82) Glutathione S-transferase {Maize (Zea mays), type III}
aplklygmplspnvvrvatvlnekgldfeivpvdlttgahkqpdflalnpfgqipalvdg
devlfesrainryiaskyase

SCOP Domain Coordinates for d1aw9_2:

Click to download the PDB-style file with coordinates for d1aw9_2.
(The format of our PDB-style files is described here.)

Timeline for d1aw9_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aw9_1