SCOP 1.55: Domain d1aw9_2: 1aw9 2-82

Lineage for d1aw9_2 (1aw9 2-82)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)

6. Protein Glutathione S-transferase [52863] (22 species)

7. Species Maize (Zea mays), type III [TaxId:4577] [52882] (1 PDB entry)

8. Domain d1aw9_2: 1aw9 2-82 [33030]
   Other proteins in same PDB: d1aw9_1

Details for d1aw9_2

PDB Entry: 1aw9, 2.2 Å

PDB Description: structure of glutathione s-transferase iii in apo form

SCOP Domain Sequences for d1aw9_2:

Sequence; same for both SEQRES and ATOM records:

>d1aw9_2 c.47.1.5 (2-82) Glutathione S-transferase {Maize (Zea mays), type III}
aplklygmplspnvvrvatvlnekgldfeivpvdlttgahkqpdflalnpfgqipalvdg
devlfesrainryiaskyase

Timeline for d1aw9_2:

• d1aw9_2 appears in SCOP 1.57
  
• d1aw9_2 appears in the current release, SCOPe 2.08, called d1aw9a2