SCOPe 2.08: Domain d1aw9a2: 1aw9 A:2-82

Lineage for d1aw9a2 (1aw9 A:2-82)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class phi GST [81367] (3 species)

7. Species Maize (Zea mays), type III [TaxId:4577] [52882] (1 PDB entry)

8. Domain d1aw9a2: 1aw9 A:2-82 [33030]
   Other proteins in same PDB: d1aw9a1
   complexed with cd

Details for d1aw9a2

PDB Entry: 1aw9, 2.2 Å

PDB Description: structure of glutathione s-transferase iii in apo form

PDB Compounds: (A:) glutathione s-transferase III

SCOPe Domain Sequences for d1aw9a2:

Sequence; same for both SEQRES and ATOM records:

>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]}
aplklygmplspnvvrvatvlnekgldfeivpvdlttgahkqpdflalnpfgqipalvdg
devlfesrainryiaskyase

Timeline for d1aw9a2:

• d1aw9a2 first appeared (with stable ids) in SCOP 1.55, called d1aw9_2
  
• d1aw9a2 appears in SCOPe 2.07